PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000345G0740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 267aa    MW: 29911.1 Da    PI: 6.2531
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000345G0740genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed+llv++v+q+  g+W+++a+  g++R++k+c++rw +yl
  PH01000345G0740 18 KGPWTAQEDKLLVEYVRQHAEGRWNSVAKLTGLKRSGKSCRLRWVNYL 65
                     79********************************************97 PP

2Myb_DNA-binding51.52.4e-1671115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  PH01000345G0740  71 RGKITPQEESVILELHALWGNR-WSTIARNLP-GRTDNEIKNYWRTH 115
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.2631365IPR017930Myb domain
SuperFamilySSF466893.07E-2916112IPR009057Homeodomain-like
SMARTSM007172.8E-151767IPR001005SANT/Myb domain
PfamPF002495.6E-171865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-231972IPR009057Homeodomain-like
CDDcd001672.37E-112065No hitNo description
PROSITE profilePS5129425.41766120IPR017930Myb domain
SMARTSM007173.3E-1570118IPR001005SANT/Myb domain
PfamPF002494.4E-1471115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2373118IPR009057Homeodomain-like
CDDcd001672.03E-1075116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MEGQQFGWGS REEGGWRKGP WTAQEDKLLV EYVRQHAEGR WNSVAKLTGL KRSGKSCRLR  60
WVNYLRPDLK RGKITPQEES VILELHALWG NRWSTIARNL PGRTDNEIKN YWRTHFNKGK  120
PSKNIERTRA RFLKQRREMQ QSQLQGQQKQ QQQQHDQDDA SADSISAASH AGETTPALTA  180
QDDLVMQDMP DMDDFLYHPI STYFFGGGGA TSASTSEAGS SEEIDGGATW GSLWNLDDVV  240
NDVDGGACCW GSACSPLLQD QGLAFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25181187106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-159AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-159AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624171.11e-123PREDICTED: transcription factor MYB57
TrEMBLA0A0E0K2H81e-125A0A0E0K2H8_ORYPU; Uncharacterized protein
STRINGOB02G31640.11e-123(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-65myb domain protein 79